I'm learning C++. I'm developing a simple "library management" application that allows users to create an account, check out books, etc. Each book is managed using a unique text file. The text file contains three lines as follows, however the third line is the only important thing here, as it contains the owner of the book.
The following code prints the contents of an additional text file that contains a list of all the books, but that shouldn't be relevant to the error. It converts the contents of the text file to a string, and then checks to see if "NA" is present. If "NA" is present, it is replaced with the current username. The file is then reopened using ios::trunc to wipe the file, and the new string is passed into the file. This works fine.
The issue is that when running the application, if a username is already there instead of "NA", I get a Debug Error that only reads abort() has been called. I've tried debugging, but I can't get any more information.
This is the error and the code:
void bookCheckout()
{
system("CLS");
string line;
string bookChoice;
ifstream checkBookList;
ofstream checkOutBook;
checkBookList.open("books/booklist.txt");
string sTotal;
string s;
cout << "<---Avaliable Books--->" << endl;
while (getline(checkBookList, line)) {
cout << line << endl;
}
checkBookList.close();
cout << "\nWhat Book Would You Like?:";
cin >> bookChoice;
checkBookList.open("books/" + bookChoice + ".txt");
while (!checkBookList.eof()) {
getline(checkBookList, s);
sTotal += s + "\n";
}
checkBookList.close();
if (sTotal.find("NA")) {
sTotal.replace(sTotal.find("NA"), 2, globalUsername);
checkOutBook.open("books/" + bookChoice + ".txt", ios::trunc);
checkOutBook << sTotal;
checkOutBook.close();
}
else if (!sTotal.find("NA")) {
cout << "Book already checked out!" << endl;
}
checkOutBook.close();
system("PAUSE");
}
There are a few issues with your code:
lack of error handling.
while (!checkBookList.eof()) - see Why is iostream::eof inside a loop condition (i.e. while (!stream.eof())) considered wrong?
if (sTotal.find("NA")) - string::find() returns an INDEX, not a BOOLEAN. If 0 is returned, that will be evaluated as false. All other values will be evaluated as true, including string::npos (-1), which is what string::find() returns if a match is not found.
Also, your goal is to check if the 3RD LINE SPECIFICALLY is "NA", so using string::find() is not the best choice for that purpose. Think of what would happen if the 1st or 2nd line happened to contain the letters NA. Your code logic would not behave properly.
else if (!sTotal.find("NA")) - no need to call find() in the else at all. Just use else by itself.
With that said, try something more like this:
void bookCheckout()
{
system("CLS");
ifstream checkBookList;
checkBookList.open("books/booklist.txt");
if (!checkBookList.is_open()) {
cerr << "Unable to open booklist.txt" << endl;
return;
}
string line;
cout << "<---Available Books--->" << endl;
while (getline(checkBookList, line)) {
cout << line << endl;
}
checkBookList.close();
cout << "\nWhat Book Would You Like?:";
string bookChoice;
getline(cin, bookChoice);
checkBookList.open("books/" + bookChoice + ".txt");
if (!checkBookList.is_open()) {
cerr << "Unable to open " + bookChoice + ".txt for reading" << endl;
return;
}
string sTotal, sOwner;
int lineNum = 0;
string::size_type ownerIndex = string::npos;
while (getline(checkBookList, line)) {
++lineNum;
if (lineNum == 3) {
sOwner = line;
ownerIndex = sTotal.size();
}
sTotal += line + "\n";
}
checkBookList.close();
if (sOwner == "NA") {
sTotal.replace(ownerIndex, 2, globalUsername);
ofstream checkOutBook("books/" + bookChoice + ".txt", ios::trunc);
if (!checkOutBook.is_open()) {
cerr << "Unable to open " + bookChoice + ".txt for writing" << endl;
return;
}
checkOutBook << sTotal;
checkOutBook.close();
cout << "Book checked out!" << endl;
}
else {
cout << "Book already checked out by " << sOwner << "!" << endl;
}
system("PAUSE");
}
Alternatively, use a std::vector to gather the book contents, that will give you indexed access to each line:
#include <vector>
void bookCheckout()
{
system("CLS");
ifstream checkBookList;
checkBookList.open("books/booklist.txt");
if (!checkBookList.is_open()) {
cerr << "Unable to open booklist.txt" << endl;
return;
}
string line;
cout << "<---Available Books--->" << endl;
while (getline(checkBookList, line)) {
cout << line << endl;
}
checkBookList.close();
cout << "\nWhat Book Would You Like?:";
string bookChoice;
getline(cin, bookChoice);
checkBookList.open("books/" + bookChoice + ".txt");
if (!checkBookList.is_open()) {
cerr << "Unable to open " + bookChoice + ".txt for reading" << endl;
return;
}
vector<string> sTotal;
sTotal.reserve(3);
while (getline(checkBookList, line)) {
sTotal.push_back(line);
}
while (sTotal.size() < 3) {
sTotal.push_back("");
}
checkBookList.close();
if (sTotal[2] == "" || sTotal[2] == "NA") {
sTotal[2] = globalUsername;
ofstream checkOutBook("books/" + bookChoice + ".txt", ios::trunc);
if (!checkOutBook.is_open()) {
cerr << "Unable to open " + bookChoice + ".txt for writing" << endl;
return;
}
for(size_t i = 0; i < sTotal.size(); ++i) {
checkOutBook << sTotal[i] << '\n';
}
checkOutBook.close();
cout << "Book checked out!" << endl;
}
else {
cout << "Book already checked out by " << sTotal[2] << "!" << endl;
}
system("PAUSE");
}
Related
I'm trying to read in a fasta file. I want to remove/ignore the header/info lines that begin with ">" and store the following sequences into sperate strings. Below is the code I have to do that (partially reworked from https://rosettacode.org/wiki/FASTA_format#C++, as what I had originally worked even less). They have a good example of what I want to do.
My problem is given this fasta file:
">sequence_1
MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVTPLPAVLGHE
GAGIVEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFI
STSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIG
CKAAGAARIIAVDINKDKFAKAKELGATECIYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCH
AACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVAKKFPLDPLITHVLPFEKIN
EAFDLLRSGKSIRTVLTF
">sequence_2
MNQGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVTPLPVILGHEA
AGIVESVGEGVTTVKPGDKVIPLFTCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGT
STFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCK
AAGAARIIAVDINKDKFAKAKELGATECINPQDYKLPIQEVLKEMTDGSTVIGRLDTMMASLLCCGTSV
IVEDTPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF
My output:
Sequence 1: MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVTPLPAVLGHEGAGIVEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATECIYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVAKKFPLDPLITHVLPFEKINEAFDLLRSGKSIRTVLTF
Sequence 2: MNQGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKLPIQEVLKEMTDGSTVIGRLDTMMASLLCCGTSVIVEDTPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
The last line or so of Sequence 2 is cut off..... Any help/solutions?
void read_in_Protein(string Protein_filename)
{ // read in the sequences
fstream myfile;
myfile.open(Protein_filename, ios::in);
if (!myfile.is_open()) {
cerr << "Error can not open file" << endl;
exit(1);
}
string Protein_Sequences{};
string Protein_Seq_names{};
// string temp{};
string Prot_Seq1{};
string Prot_Seq2{};
string line{};
while (getline(myfile, line).good()) {
//std::cout << "Line input received (" << line.length() << "): " << line << std::endl;
if (line.empty() || line[0] == '>') { // Identifier marker
if (!Protein_Seq_names.empty()) { // Print out what we read from the last entry
//std::cout << "\tReseting to new sequence" << std::endl;
// cout << Protein_Sequences << endl;
Protein_Seq_names.clear();
Prot_Seq1 = Protein_Sequences;
}
if (!line.empty()) {
//std::cout << "\tSetting sequence start" << std::endl;
Protein_Seq_names = line.substr(1);
}
// std::cout << "\tClearing sequences..." << std::endl;
Protein_Sequences.clear();
}
else if (!Protein_Seq_names.empty()) {
line = line.substr(0, line.length() - 1);
if (line.find(' ') != string::npos) { // Invalid sequence--no spaces allowed
//std::cout << "\tSpace found, clearing buffers..." << std::endl;
Protein_Seq_names.clear();
Protein_Sequences.clear();
}
else {
//std::cout << "\tAppending line to protein sequence..." << std::endl;
Protein_Sequences += line;
}
}
//std::cout << "Protein_Sequences: " << Protein_Sequences << std::endl;
}
if (!Protein_Seq_names.empty()) { // Print out what we read from the last entry
// cout << Protein_Sequences << endl;
Prot_Seq2 = Protein_Sequences;
}
cout << "\nSequence 1: " << Prot_Seq1 << endl;
cout << Prot_Seq1.length();
cout << "\nSequence 2: " << Prot_Seq2 << endl;
cout << Prot_Seq2.length();
}
Assuming your file doesn't end with a new line then the last call to std::getline will set the eof bit to indicate that it reached the end of the file before finding the line ending. As you are checking .good() in your while loop the last line will be discarded. You should instead check !fail() (or just the boolean value of the stream itself which is equivalent to !fail()):
while (getline(myfile, line))
After reading the final line the next iteration of the loop will try to read whilst the stream is in the eof state and immediately fail and break out of the loop.
I've written a readFile function for a project I'm working on. I call it once, load in a file and read in it's contents - works fine
However, when I try to load it a second time, attempting to change the file name - it loads it in, saves it to a static string 'path' that I access in a different function - but then the function is not printing the data
The question is, how do I change the file name, and read it in successfully on the second iteration? The part that has me stumped is that it works once, but not twice
Ive attempted to use cin.ignore(); cin.clear(); cin.sync() on the second iteration of fileName function - but none of them allow a separate file to be read successfully.
Minimum Reproducible Example:
#include <iostream>
#include <fstream>
#include <string>
#include <stdlib.h>
#include <vector>
#include <sstream>
#include <iomanip>
#include <iostream>
using namespace std;
static string path;
string opt;
void readFile();
int fileName();
void menu() { // put in while loop - while True
cout << "----------------------" << endl;
cout << "R(ead) -" << "Read File" << endl;
cout << "F(ile) -" << "Set Filename" << endl;
cout << "\nPlease select from the above options" << endl;
cin >> opt;
cout << "\nInput entered: " << opt << endl;
if (opt == "R") {
readFile();
}
if (opt == "F") {
fileName();
}
}
void readFile() { // doing this twice
ifstream readFile;
readFile.open(path);
if (!readFile.is_open()) {
cout << "Could not read file" << endl;
}
string str;
int i = 0;
while (getline(readFile, str))
{
if (str[0] != '/')
{
cout << "DEBUG: Line is - " << str << endl;
}
}
readFile.clear();
readFile.close();
menu();
}
int fileName() {
cout << "File path: ";
if (path != "") {
cin.ignore();
cin.clear();
cin.sync();
}
getline(cin, path);
ifstream file(path.c_str());
if (!file) {
cout << "Error while opening the file" << endl;
return 1;
}
cout << "(File loaded)" << endl;
cout << "Path contains: " << path << endl;
file.clear();
file.close();
menu();
}
int main()
{
fileName();
}
Sample text, saved as txt file and read in using path:
Data1.txt
// standard test file
123,Frodo inc,2006, lyons,"1,021,000.16",0.0,
U2123,Sam Inc,2006, lyons,"21,600.00",13.10,123
A721,Merry Inc,2604, Kingston,"21,600.10",103.00,
U2122,Pippin Inc,2612, reid,"21,600.00",0
U1123,Huckelberry corp,2612, Turner,"21,600.00",13.10,
Data2.txt
7101003,Mike,23 boinig road,2615,48000,12000,0
7201003,Jane Philips,29 boinig cresent,2616,47000,12000,0
7301003,Philip Jane,23 bong road,2615,49000,000,0
7401004,Peta,23 bong bong road,2615,148000,19000,0
7101205,Abdulla,23 Station st,2615,80000,21000,0
The problem comes from reading in one, and trying to read in the other after the first has been executed.
Enter Filename
Hit Readfile
Return to menu, hit Set Filename
Change to Data2.txt
Readfile again. Not working
My tutor told me "That's not how functions work in c++" but didn't elaborate further, and is unavailable for contact.
In general, do not use global variables. The path variable should be passed as a parameter, not kept as a global variable altered between function calls, as this leads to many side effects and is the source of countless bugs. See the following refactoring:
void menu() { // put in while loop - while True
while(true)
{
//Keep this as a local variable!
std::string opt;
std::string filename;
cout << "----------------------\n";
cout << "R(ead) -" << "Read File\n";
cout << "F(ile) -" << "Set Filename\n";
cout << "\nPlease select from the above options\n";
cin >> opt;
cout << "\nInput entered: " << opt << '\n';
if (opt == "R") {
readFile(filename);
}
if (opt == "F") {
filename = getFileName();
}
}
}
void readFile(const std::string & filename) {
ifstream readFile;
readFile.open(filename);
if (!readFile.is_open()) {
cout << "Could not read file " << filename << '\n';
}
string str;
int i = 0;
while (getline(readFile, str))
{
if (str[0] != '/')
{
cout << "DEBUG: Line is - " << str << '\n';
}
}
readFile.close();
//just return to get back to menu
return;
}
std::string getFileName() {
cout << "File path: ";
std::string path;
getline(cin, path);
ifstream file(path.c_str());
if (!file) {
cout << "Error while opening the file" << '\n';
//Instead of returning an error code use an exception preferably
}
cout << "(File loaded)" << '\n';
cout << "Path contains: " << path << '\n';
file.close();
return path;
}
Other notes:
Ideally, do input in output in just one function, not all three as it gets confusing exactly what each function is responsible for.
If you want something to hold a file and print the contents, you can use an class.
The file is checked if it is openable twice, not really any reason to do this just delegate that responsibility to one function.
One of the best things about C++ is RAII and deterministic lifecycles for objects and primitives - use it!! Do not give everything a long life with global variables - use smart parameters and return values instead.
I'm making a very simple file parser, in CSV style. The compilation runs smoothly, and when I run it, I'm having a segfault (core dumped). The only printed line is the one telling "Done" to say that the file succesfully opened. So my guess is that the Segfault happened during while(getline(myfile, line)).
Here's my code (parser.cpp):
#include "parser.h"
vector<string> str_explode(string const & s, char delim)
{
vector<string> result;
istringstream iss(s);
for (string token; getline(iss, token, delim); )
{
result.push_back(move(token));
}
return result;
}
vector<vector<string>> getTokensFromFile(string fileName)
{
bool verbose = true;
if(verbose)
cout << "Entering getTokensFromFile(" << fileName << ")" << endl ;
/* declaring what we'll need :
* string line -> the line beeing parsed
* ifstream myfile -> the file that name has been given as parameter
* vector <vector <string> > tokens -> the return value
*
* Putting all line into tokens
*/
string line;
ifstream myfile(fileName);
vector< vector<string> > tokens;
if(verbose)
cout << "Opening file " << fileName << " ... ";
if (myfile.is_open())
{
if(verbose)
cout << "Done !" << endl;
while (getline (myfile,line))
{
if(verbose)
cout << "Parsing line '" << line << "'. ";
// If line is blank or start with # (comment)
// then we don't parse it
if((line.length() == 0) || (line.at(0) == '#'))
{
if(verbose)
cout << "Empty or comment, passing.";
continue;
}
else
{
vector <string> tmptokens;
if(verbose)
cout << "Adding token " << tmptokens[0] << " and its values.";
tokens.push_back(tmptokens);
}
cout << endl;
}
}
else
{
cout << "Unable to open file " << fileName << endl;
throw exception();
}
if(verbose)
cout << "Exiting getTokensFromFile(" << fileName << ")" << endl;
return tokens;
}
main.cpp
#include "parser.h"
int main()
{
getTokensFromFile("testfile.csv");
return 0;
}
And my testfile.csv
version;1.3
###### SPECIE ######
SpecieID;Value1
VariantID;Value2
####################
##### IDENTITY #####
Name;Value3
DOName;Value4
####################
All files are in the same folder.
Do you have any clue why I'm having this segfault?
Thanks
Here is one obvious error, where you are accessing a vector's element out-of-bounds. Accessing an out-of-bounds element is undefined behavior.
else
{
vector <string> tmptokens;
if(verbose)
cout << "Adding token " << tmptokens[0] << " and its values.";
tokens.push_back(tmptokens);
}
Since tmptokens is empty, there is no tmptokens[0].
If the vector is empty, you could have done this:
else
{
if(verbose)
cout << "Adding new token and its values.";
tokens.push_back({});
}
There is no need to manually create an empty vector starting with C++11.
I have an assignment where I must create a function that takes a filename as a parameter, opens the file, asks a user to enter a value to be searched for, and then searches the file for that value. The file I was given to use for this assignment is a file with a list of revenue and expense values. I have tried just about everything and keep receiving the "value not found" prompt even when I enter a value that i know is in the file.
The code is
void numberSearch(string fileName)
{
string searchVal;
cout << "\nWhat value would you like to search for?\n";
cin.ignore();
getline(cin, searchVal);
ifstream file; //create input file object that will be read from
file.open(fileName); //"ifstream file (fileName)"
if (!file)
{
cout << "\nUnable to open file.\n";
exit(1);
}
string words;
int curLine = 0; //file line counter
while (getline(file, words))
{
++curLine; //counts each line in the file
if (words.find(searchVal) != string::npos)
{
cout << "\nLine " << curLine << " contains " << searchVal << endl;
file.close();
return;
}
else
{
cout << "\nThe value " << searchVal << " was not found.\n";
file.close();
return;
}
}
}
Any help is greatly appreciated
You need to put the else part out side of while loop. Otherwise your function will only search for the first line.
I was bored so I decided to do it too. I'll post mine, even though its already solved. (upvoted the question for the fun of solving ;) )
using namespace std;
int testfile(string filename, int &line, int &character)
{
ifstream is(filename, std::ios::in);
if (!is.is_open()) return 1; //1 = no file
cout << "Search for what value?" << endl;
string value;
cin >> value;
string buf;
while (getline(is,buf))
{
++line;
if (buf.find(value) != buf.npos)
{
character=buf.find(value); //the part that got lost in edit
return 0; //value found, returning 0
}
}
return 2; //return 2 since no value was found
}
which is called under main():
main()
{
int line=0; //what line it is
int character=0; //what character on that line
int result=testfile("test.txt", line, character); //debug+passing as reference
if (result == 1)cout << "could not find file" << endl;
if (result == 2)cout << "could not find value" << endl;
if (result == 0)
cout << "found at line# " << line << " character# " << character << endl;
return 0;
}
Passing values by reference lets us make use of them in our original scope. Therefore the function can both give errors for debugging, and allow useful results for our scopes purpose.
Closing the fstream is not necessary, as leaving the scope will take care of that for us: see here
Hehe, almost like being at school ;)
I would like to ask about my problem I tried to read Getline and EOF Question but did not help.
Problem is I have no idea where could be mistake here:
Is there some problem with used function ( getline or checking EOF ) ?
If there is no text in text.txt file it says there something was found. But I have no idea why or where I made a mistake ...
What I want is: Search for string and if there is no text in txt file I want it to says EOF or something. It still says - even if file is empty - string I was looking for was found in line one , position one - for example
I am puting there code:
#include <iostream>
#include <fstream>
#include <string>
using namespace std;
int openFile(void);
int closeFile(void);
int getTime(void);
int findTime();
int findDate();
int stringFind(string);
bool getOneLine(void);
string what;
bool ifound = false;
string foundstring;
string filename ;
fstream inputfile;
string sentence ;
size_t found ;
string foundTime ;
string foundDate ;
bool timeIsHere = false;
bool dateIsHere = false;
int iterTime = 0;
int iterDate = 0;
int line = 0;
int main (void){
sentence.clear();
cout << " Enter the file name:" << endl;
openFile();
while (getOneLine() != false) {
stringFind("Time");
}
cout << "END OF PROGRAM" << endl;
system("PAUSE");
///getTime();
closeFile();
system("PAUSE");
}
int closeFile(void) {
inputfile.close();
cout << " File: " << filename << " - was closed...";
return 0;
}
int openFile(void) {
cout << " Insert file name in program directory or full path to desired file you want to edit:"<<endl;
cout << " Do not use path with a space in directory address or filename ! " << endl;
cout<<" ";
getline(cin, filename);
inputfile.open(filename, ios::in);
cout <<" file_state: " << inputfile.fail();
if (inputfile.fail() == 1) {
cout << " - Cannot open your file" << endl;
}
else cout << " - File was openned sucesfully"<< endl;
return 0;
}
int stringFind(string what) {
cout << " I am looking for:" << what << endl;
found = what.find(sentence);
if (found == string::npos) {
cout << " I could not find this string " << endl;
}
else if(found != string::npos){
cout << " substring was found in line: " << line + 1 << " position: " << found + 1 << endl << endl;
ifound = true;
foundstring = sentence;
}
return 0;
}
bool getOneLine(void) {
if (inputfile.eof()) {
cout << "END OF FILE" << endl << endl;
return false;
}
else{
getline(inputfile, sentence);
cout << "next sentence is: "<< sentence << endl;
return true;
}
}
I am newbie and I have no one to ask - personally . I tried to edit While cycle and IF's to make sure that I did not make a serious mistake but I have no idea.
I tried it with for example sample.txt and this file was empty.
Always test whether input succeeded after the read attempt! The stream cannot know what you are attempting to do. It can only report whether the attempts were successful so far. So, you'd do something like
if (std::getline(stream, line)) {
// deal with the successful case
}
else {
// deal with the failure case
}
In the failure case you might want to use use eof() to determine whether the failure was due reaching the end of the stream: Having reached the end of file and, thus, std::ios_base:eofbit being set is often not an error but simply the indication that you are done. It may still be an error, e.g., when it is known how many lines are to be read but fewer lines are obtained.
Correct way to use getline() and EOF checking would be like this:
bool getOneLine(void) {
if (getline(inputfile, sentence)) {
cout << "next sentence is: "<< sentence << endl;
return true;
}
if (inputfile.eof())
cout << "EOF reached" << endl;
else
cout << "Some IO error" << endl;
return false;
}
You have one mistake here:
found = what.find(sentence);
You are seeking inside of what for the sentence. If sentence is empty, it will be found.
Change it to
found = sentence.find(what);
You should definitivly learn how to use a debugger. That way you would find such issues pretty fast!