Pattern matching exact word and delete in Perl - regex

I am using Perl to clean up a raw text file which contains some odd characters like the following:
printableNNH=0A=0A =0A=0A=0A Event Registration Request=0A=0A ...
There are many occurances of =0A in the file which I have to get rid of. They occure in random sets of like above where there is an example of 2 and 3.
I am using the following line in my Perl script to eliminate there characters:
tr/=0A//d; #remove =0A
That works but it also removes the zeros (0) from all telephone numbers and other content containing 0s.
Can anyone advise on pattern matching an exact substring and deleting it?

tr/// is not a regular expression: It will (with the -d modifier) substitute single characters with zero characters.
In your case, using tr/=0A// will replace every occurrence of = 0 and A with nothing.
s/// however, is a substitution operator, which will substitute a regular expression with a specified character string - in your case zero characters.
Thus, use:
open my $input, '<', 'in.txt' or die "$!";
while (<$input>){
chomp;
s/=0A//g;
print "$_\n";
}

perl -pe 's/=0A//g' inFile > outFile

Use the following if you only want to remove =0A and not =,0 or A
$string=~s/=0A//g;

From perlop:
tr/SEARCHLIST/REPLACEMENTLIST/cds
y/SEARCHLIST/REPLACEMENTLIST/cds
Transliterates all occurrences of the characters found in the search list with the corresponding character in the replacement list.
Instead of replacing all occurrences of =0A, tr replaces all occurrences of =, 0, and A:
perl -we '$_ = "foo=0AbAr0"; tr/=0A//d; print'
Prints:
foobr
Instead, you should use s/pattern/replacement/, e.g.
perl -we '$_ = "foo=0AbAr0"; s/=0A//g; print'
Prints:
foobAr0
The g modifier performs the replacement globally, i.e. for every occurrence in a line.

Related

perl match consecutive newlines: `echo "aaa\n\n\nbbb" | perl -pe "s/\\n\\n/z/gm"`

This works:
echo "aaa\n\n\nbbb" | perl -pe "s/\\n/z/gm"
aaazzzbbbz
This doesn't match anything:
echo "aaa\n\n\nbbb" | perl -pe "s/\\n\\n/z/gm"
aaa
bbb
How do I fix, so the regex matches two consecutive newlines?
A linefeed is matched by \n
echo "a\n\n\b" | perl -pe's/\n/z/'
This prints azzb, and without the following newline, so with the next prompt on the same line. Note that the program is fed one line at a time so there is no need for /g modifier. (And which is why \n\n doesn't match.) That /m modifier is then unrelated to this example.†
I don't know in what form this is used but I'd imagine not with echo feeding the input? Then better test it with input in a file, or in a multi-line string (in which case /g may be needed).
An example
use warnings;
use strict;
use feature 'say';
# Test with multiline string
my $ml_str = "a\n\nb\n";
$ml_str =~ s/\n/z/g; #--> azzbz (no newline at the end)
print $ml_str;
say ''; # to terminate the line above
# Or to replace two consecutive newlines (everywhere)
$ml_str = "a\n\nb\n"; # restore the example string
$ml_str =~ s/\n\n/z/g; #--> azb\n
print $ml_str;
# To replace the consecutive newlines in a file read it into a string
my $file = join '', <DATA>; # lines of data after __DATA__
$file =~ s/\n\n/z/g;
print $file;
__DATA__
one
two
last
This prints
azzbz
azb
one
twoz
last
As a side note, I'd like to mention that with the modifier /s the . matches a newline as well. (For example, this is handy for matching substrings that may contain newlines by .* (or .+); without /s modifier that pattern stops at a newline.)
See perlrebackslash and search for newline.
† The /m modifier makes ^ and $ also match beginning and end of lines inside a multi-line string. Then
$multiline_string =~ s/$/z/mg;
will replace newlines inside the string. However, this example bears some complexities since some of the newlines stay.
You are applying substitution to only one line at a time, and one line will never have two newlines. Apply the substitution to the entire file instead:
perl -0777 -pe 's/\n\n/z/g'

Repeating regex pattern

I have a string such as this
word <gl>aaa</gl> word <gl>aaa-bbb=ccc</gl>
where, if there is one ore more words enclosed in tags. In those instances where there are more than one words (which are usually separated by - or = and potentially other non-word characters), I'd like to make sure that the tags enclose each word individually so that the resulting string would be:
word <gl>aaa</gl> word <gl>aaa</gl>-<gl>bbb</gl>=<gl>ccc</gl>
So I'm trying to come up with a regex that would find any number of iterations of \W*?(\w+) and then enclose each word individually with the tags. And ideally I'd have this as a one-liner that I can execute from the command line with perl, like so:
perl -pe 's///g;' in out
This is how far I've gotten after a lot of trial and error and googling - I'm not a programmer :( ... :
/<gl>\W*?(\w+)\W*?((\w+)\W*?){0,10}<\/gl>/
It finds the first and last word (aaa and ccc). Now, how can I make it repeat the operation and find other words if present? And then how to get the replacement? Any hints on how to do this or where I can find further information would be much appreciated?
EDIT:
This is part of a workflow that does some other transformations within a shell script:
#!/bin/sh
perl -pe '#
s/replace/me/g;
s/replace/me/g;
' $1 > tmp
... some other commands ...
This needs a mini nested-parser and I'd recommend a script, as easier to maintain
use warnings;
use strict;
use feature 'say';
my $str = q(word <gl>aaa</gl> word <gl>aaa-bbb=ccc</gl>);
my $tag_re = qr{(<[^>]+>) (.+?) (</[^>]+>)}x; # / (stop markup highlighter)
$str =~ s{$tag_re}{
my ($o, $t, $c) = ($1, $2, $3); # open (tag), text, close (tag)
$t =~ s/(\w+)/$o$1$c/g;
$t;
}ge;
say $str;
The regex gives us its built-in "parsing," where words that don't match the $tag_re are unchanged. Once the $tag_re is matched, it is processed as required inside the replacement side. The /e modifier makes the replacement side be evaluated as code.
One way to provide input for a script is via command-line arguments, available in #ARGV global array in the script. For the use indicated in the question's "Edit" replace the hardcoded
my $str = q(...);
with
my $str = shift #ARGV; # first argument on the command line
and then use that script in your shell script as
#!/bin/sh
...
script.pl $1 > output_file
where $1 is the shell variable as shown in the "Edit" to the question.
In a one-liner
echo "word <gl>aaa</gl> word <gl>aaa-bbb=ccc</gl>" |
perl -wpe'
s{(<[^>]+>) (.+?) (</[^>]+>)}
{($o,$t,$c)=($1,$2,$3);$t=~s/(\w+)/$o$1$c/g; $t}gex;
'
what in your shell script becomes echo $1 | perl -wpe'...' > output_file. Or you can change the code to read from #ARGV and drop the -n switch, and add a print
#!/bin/sh
...
perl -wE'$_=shift; ...; say' $1 > output_file
where ... in one-liner indicate the same code as above, and say is now needed since we don't have the -p with which the $_ is printed out once it's processed.
The shift takes an element off of an array's front and returns it. Without an argument it does that to #ARGV when outside a subroutine, as here (inside a subroutine its default target is #_).
This will do it:
s/(\w+)([\-=])(?=\w+)/$1<\/gl>$2<gl>/g;
The /g at the end is the repeat and stands for "global". It will pick up matching at the end of the previous match and keep matching until it doesn't match anymore, so we have to be careful about where the match ends. That's what the (?=...) is for. It's a "followed by pattern" that tells the repeat to not include it as part of "where you left off" in the previous match. That way, it picks up where it left off by re-matching the second "word".
The s/ at the beginning is a substitution, so the command would be something like:
cat in | perl -pne 's/(\w+)([\-=])(?=\w+)/$1<\/gl>$2<gl>/g;$_' > out
You need the $_ at the end because the result of the global substitution is the number of substitutions made.
This will only match one line. If your pattern spans multiple lines, you'll need some fancier code. It also assumes the XML is correct and that there are no words surrounding dashes or equals signs outside of tags. To account for this would necessitate an extra pattern match in a loop to pull out the values surrounded by gl tags so that you can do your substitution on just those portions, like:
my $e = $in;
while($in =~ /(.*?<gl>)(.*?)(?=<\/gl>)/g){
my $p = $1;
my $s = $2;
print($p);
$s =~ s/(\w+)([\-=])(?=\w+)/$1<\/gl>$2<gl>/g;
print($s);
$e = $'; # ' (stop markup highlighter)
}
print($e);
You'd have to write your own surrounding loop to read STDIN and put the lines read in into $in. (You would also need to not use -p or -n flags to the perl interpreter since you're reading the input and printing the output manually.) The while loop above however grabs everything inside the gl tags and then performs your substitution on just that content. It prints everything occurring between the last match (or the beginning of the string) and before the current match ($p) and saves everything after in $e which gets printed after the last match outside the loop.

regular expression that matches any word that starts with pre and ends in al

The following regular expression gives me proper results when tried in Notepad++ editor but when tried with the below perl program I get wrong results. Right answer and explanation please.
The link to file I used for testing my pattern is as follows:
(http://sainikhil.me/stackoverflow/dictionaryWords.txt)
Regular expression: ^Pre(.*)al(\s*)$
Perl program:
use strict;
use warnings;
sub print_matches {
my $pattern = "^Pre(.*)al(\s*)\$";
my $file = shift;
open my $fp, $file;
while(my $line = <$fp>) {
if($line =~ m/$pattern/) {
print $line;
}
}
}
print_matches #ARGV;
A few thoughts:
You should not escape the dollar sign
The capturing group around the whitespaces is useless
Same for the capturing group around the dot .
which leads to:
^Pre.*al\s*$
If you don't want words like precious final to match (because of the middle whitespace, change regex to:
^Pre\S*al\s*$
Included in your code:
while(my $line = <$fp>) {
if($line =~ /^Pre\S*al\s*$/m) {
print $line;
}
}
You're getting messed up by assigning the pattern to a variable before using it as a regex and putting it in a double-quoted string when you do so.
This is why you need to escape the $, because, in a double-quoted string, a bare $ indicates that you want to interpolate the value of a variable. (e.g., my $str = "foo$bar";)
The reason this is causing you a problem is because the backslash in \s is treated as escaping the s - which gives you just plain s:
$ perl -E 'say "^Pre(.*)al(\s*)\$";'
^Pre(.*)al(s*)$
As a result, when you go to execute the regex, it's looking for zero or more ses rather than zero or more whitespace characters.
The most direct fix for this would be to escape the backslash:
$ perl -E 'say "^Pre(.*)al(\\s*)\$";'
^Pre(.*)al(\s*)$
A better fix would be to use single quotes instead of double quotes and don't escape the $:
$ perl -E "say '^Pre(.*)al(\s*)$';"
^Pre(.*)al(\s*)$
The best fix would be to use the qr (quote regex) operator instead of single or double quotes, although that makes it a little less human-readable if you print it out later to verify the content of the regex (which I assume to be why you're putting it into a variable in the first place):
$ perl -E "say qr/^Pre(.*)al(\s*)$/;"
(?^u:^Pre(.*)al(\s*)$)
Or, of course, just don't put it into a variable at all and do your matching with
if($line =~ m/^Pre(.*)al(\s*)$/) ...
Try removing trailing newline character(s):
while(my $line = <$fp>) {
$line =~ s/[\r\n]+$//s;
And, to match only words that begin with Pre and end with al, try this regular expression:
/^Pre\w*al$/
(\w means any letter of a word, not just any character)
And, if you want to match both Pre and pre, do a case-insensitive match:
/^Pre\w*al$/i

How to specify number of paragraphs in perl

I Want to find number of occurrences of new line in perl using regex.
How to define number of occurrences of newline in perl.
For example
I have text containing
dog
cat
other 23 newlines
puppy
Kitten
I am able to do regex using notepad Find "(dog)((?:.*[\r\n]+){25})(\w.*)" and replace with "\1 = \3 \2"
EDIT
Important thing is that, How to find what is on paragraph 25 from dog.
More simpler way.
How to shorten this find string
(dog)(.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+.*[\r\n]+)(.*)
what is the alternative to specific numbers of new lines in Perl?
By mistake posted on superuser, Now Moved here.
You can skip the lines when reading the input:
while (<>) {
if (/dog/) {
<> for 1 .. 24;
print scalar <>;
}
}
Or, if the whole string is the input, you can use a non-capturing group:
my ($puppy) = $string =~ /dog(?:.*\n){25}(.*)/;
print $puppy;
In a regex, a dot doesn't match a newline (unless the /s modifier is used).
You can use the tr/// operator (see perlop) to count the number of occurrences of a single character.
#!/usr/bin/perl
use warnings;
use strict;
my $string = 'dog
cat
other 23 newlines
puppy
Kitten';
print $string =~ tr/\n//, "\n";
Output:
4
This was the answer I wanted.
perl -i.bak -pe "BEGIN{undef $/;} s/(dog)(.*[\r\n]+){23}(.*)/$1 = $3/smg" 1.rtf

How to remove the whitespaces in fasta file using perl?

My fasta file
>1a17_A a.118.8 TPR-like
PADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRS
LAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDY
ETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIES
MTIEDEYS
Else try this http://www.ncbi.nlm.nih.gov/nuccore/?term=keratin for fasta files.
open(fas,'d:\a4.fas');
$s=<fas>;
#fasta = <fas>;
#r1 = grep{s/\s//g} #fasta; #It is not remove the white space
#r2 = grep{s/(\s)$//g} #fasta; #It is not working
#r3 = grep{s/.$//g} #fasta; #It is remove the last character, but not remove the last space
print "#r1\n#r2\n#r3\n";
These codes are give the outputs is:
PADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRS LAYLRT
ECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDY ETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAG
DEHKRSVVDSLDIES MTIEDEYS
I expect Remove the whitespaces from line two and above the lines. How can i do it?
Using perl one liner,
perl -i -pe 's|[ \t]||g' a4.fas
removing all white spaces, including new lines,
perl -i -pe 's|\s||g' a4.fas
use strict;
use warnings;
while(my $line = <DATA>) {
$line =~ s/\s+//g;
print $line;
}
__DATA__
PADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRS
LAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDY
ETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIES
MTIEDEYS
grep is the wrong choice to make changes to an array. It filters the elements of the input array, passing as output only those elements for which the expression in the braces { .. } is true.
A substitution s/// is true unless it made no changes to the target string, so of your grep statements,
#r1 = grep { s/\s//g } #fasta
This removes all spaces, including newlines, from the strings in #fasta. It puts in #r1 only those elements that originally contained whitespace, which is probably all of them as they all ended in newline.
#r2 = grep { s/(\s)$//g } #fasta
Because of the anchor $, this removes the character before the newline at the end of the string if it is a whitespace character. It also removes the newline. Any whitespace before the end of the string is untouched. It puts in #r2 only those elements that end in whitespace, which is probably all of them as they all ended in newline.
#r3 = grep { s/.$//g } #fasta;
This removes the character before the newline, whether it is whitespace or not. It leaves the newline, as well as any whitespace before the end. It puts in #r3 only those elements that contain more than just a newline, which again is probably all of them.
I think you want to retain the newlines (which are normally considered as whitespace).
This example will read the whole file, apart from the header, into the variables $data, and then use tr/// to remove spaces and tabs.
use strict;
use warnings;
use 5.010;
use autodie;
my $data = do {
open my $fas, '<', 'D:\a4.fas';
<$fas>; # Drop the header
local $/;
<$fas>;
};
$data =~ tr/ \t//d;
print $data;
Per perlrecharclass:
\h matches any character considered horizontal whitespace; this includes the platform's space and tab characters and several others listed in the table below. \H matches any character not considered horizontal whitespace. They use the platform's native character set, and do not consider any locale that may otherwise be in use.
Therefore the following will display your file with horizontal spacing removed:
perl -pe "s|\h+||g" d:\a4.fas
If you don't want to display the header, just add a condition with $.
perl -ne "s|\h+||g; print if $. > 1" d:\a4.fas
Note: I used double quotes in the above commands since your D:\ volume implies you're likely on Windows.